EGFP, recombinant protein

Description
Purified recombinant Enhanced Green Fluorescent Protein (EGFP); full length protein; fused to 6xHis-tag

Applications

  • Immunoprecipitation: use ~5 µg EGFP per 25 µL GFP-Trap® bead slurry
  • SDS-PAGE: use ~ 1 µg EGFP per lane
  • Western blot: use ~25 ng - 100 ng EGFP per lane
  • ELISA: coat ~ 1ng - 50 ng per well of a 96-well plate
  • General: as a fluorescent standard and for calibration
Product Size Code Price Buy
Product EGFP, recombinant purified protein Size 250 µg Code EGFP-250 Price $ 275
Buy +

Form
Liquid; buffered aqueous solution; protein concentration 1g/L

Size
250 µL

Purity
> 80% by SDS-PAGE

Origin
Engineered from Aequorea victoria

Sequence
MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKLEHHHHHH

Molecular Weight
28.0 kDa

Preservative
0.09% sodium azide

Storage instructions
Shipped at +4°C. Store at +4°C short term (up to 1 week). Store at -20°C or -80°C long term. Avoid freeze-thaw cycles. Stable for one year. 

Is it possible to elute bound proteins from GFP-Trap® with free GFP?

You may try to elute with free GFP. However, please be aware that this method will not quantitatively elute your fusion protein of interest.

Download Whitepaper
Order Free Test-Sample
Email newsletter

Only for research applications, not for diagnostic or therapeutic use!